PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0606s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 323aa    MW: 36423.6 Da    PI: 5.1651
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0606s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-092562882355
                             SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +yp++ee+++L++ +gL+++q+ +WF N+R ++
  SapurV1A.0606s0090.1.p 256 PYPTEEEKAKLSEITGLDQKQINNWFINQRKRH 288
                             8*****************************885 PP

2ELK30.39.5e-11209229222
                     ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                             LK +L+rKYsg+L +L++EF+
  SapurV1A.0606s0090.1.p 209 LKGMLMRKYSGHLRNLRKEFL 229
                             9*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-2065109IPR005540KNOX1
PfamPF037903.1E-2066105IPR005540KNOX1
SMARTSM012563.7E-26112163IPR005541KNOX2
PfamPF037917.2E-25115162IPR005541KNOX2
PROSITE profilePS512139.917208228IPR005539ELK domain
SMARTSM011881.1E-5208229IPR005539ELK domain
PfamPF037895.8E-7209229IPR005539ELK domain
PROSITE profilePS5007112.131228291IPR001356Homeobox domain
SuperFamilySSF466891.45E-18230301IPR009057Homeodomain-like
SMARTSM003899.3E-13230295IPR001356Homeobox domain
CDDcd000865.33E-14232292No hitNo description
Gene3DG3DSA:1.10.10.603.4E-27233293IPR009057Homeodomain-like
PfamPF059201.4E-16248287IPR008422Homeobox KN domain
PROSITE patternPS000270266289IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MEEFYRFNPT FFSSSPNDIV RPENLPAANF SDATTSTPTE FHSQASSFLQ AGHGHREVTG  60
SDMYDAIKTQ IANHPRYPDL VSAHLECQKV GAPPEMVSLL EAIGRGNYKI NTCYEIGADP  120
ELDEFMESYC EVLHRYKEEL SKPFDEAATF LSSIESQLSS LCKGTLTKIF DYGSADEPAG  180
TSEEELSCGE VEAPESQETT SVGSHEQNLK GMLMRKYSGH LRNLRKEFLK NRKKGKLPKD  240
ARTMLLDWWN HHSRWPYPTE EEKAKLSEIT GLDQKQINNW FINQRKRHWK PSEDMRFTRM  300
DGVSGDPGGA LCYGFAGDDI GI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2090451e-100AC209045.1 Populus trichocarpa clone POP061-B03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382394.10.0hypothetical protein POPTR_0005s01720g
SwissprotQ9FP292e-91KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLU5GD070.0U5GD07_POPTR; Uncharacterized protein
STRINGPOPTR_0005s01720.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.14e-81KNOTTED-like from Arabidopsis thaliana 2